V-606

£154.99
sold in last hours

Description: Embroidered Velvet front with sequenceEmbroidered Velvet back with sequenceEmbroidered Velvet sleeves with sequenceEmbroidered sleeves Organza border with sequenceEmbroidered Shirt Organza border with sequence (Front & Back)Ready Embroidered Organza dupatta with...

Delivery Timeline: This article will take approximately 4 to weeks delivered subject to availability.

Size Chart

Size: XS

XS
S
M
L
XL
Customised
Add to Wishlist

apple paygoogle paypaypalvisamasterklarnaclearpay
People are viewing this right now
Vendor: Ramsha
Availability : In Stock Pre order Out of stock
Description

Description:

Embroidered Velvet front with sequence
Embroidered Velvet back with sequence
Embroidered Velvet sleeves with sequence
Embroidered sleeves Organza border with sequence
Embroidered Shirt Organza border with sequence (Front & Back)
Ready Embroidered Organza dupatta with sequence
Raw silk trouser

For Customized Outfits

Please note that the suit will be stitched as per the style and cut in the pictures advertised.
However, if you would like your suit to be made in a straight cut or normal fit, or if you would like your suit to be custom made we need your measurements within 24 hours of placing the order. Please send your instructions and measurements us on our WhatsApp.

Shipping & Delivery

Pre-Order
All items are pre-order unless listed as ready to ship stock.

Pre-orders have 4-5 weeks of delivery time subject to availability.

Ready To Ship Stock will be delivered in 3-5 working days.

International delivery have 4-6 weeks delivery time.

Product Disclaimer

Product Disclaimer:

Majority of our items are hand embroidered/embellished and therefore delicate and breakable in their usage, while having a 5%-10% variation possibility.

By placing an order on our website, you accept the possibility of variation in comparison to the images provided on this website. Every effort is made to ensure variation is minimal. Please also, note that brands don’t provide all the laces, embellishments, buttons or motifs with the suits. It is a common practice by most brands. And for that reason, it is impossible to have the suit look identical to the pictures. However, we try our best to complete the look as close as possible to the pictures.

    The colour of a product may change/differ a little from what is shown on our website. This can be due to light variation at the time of photography and/or due to the way digital media devices display colours and also the designers Photoshop editing.

      From time to time beading/ sequences may get displaced and this is not thought of as a fault but is due to the nature of the handmade work. We are not to be held responsible for variation and or beading/sequences displacement.

        Please note that these articles of clothing should be worn with care and all clothing products sold on this website are recommended to be dry-cleaned. We will not be responsible for any claims resulting due to damage caused by washing, using another method than advised.

        Most of the time is only 2.5 meters fabric for the shirt and 2.5 meters for the trousers to make a simple suit. The dupattas also don’t come fully completed (or ready) by the brand and might not look exactly how it’s been advertised.

        There may be a slight colour difference in the actual suit and the picture is due to lighting. Please provide your correct measurements if you’d like your suit to be customised. However, if you’ve not chosen the customers options or have not provided your measurements, your order will be made according to your chosen size and as per our size chart.

        If you have any special requests with regards to lining the sleeves or having a matching scarf mode, please send us your request at the same time when you place the order with us. You can provide this information either by email or on WhatsApp.